SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021010 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021010
Domain Number 1 Region: 21-140
Classification Level Classification E-value
Superfamily Lysozyme-like 8.96e-36
Family C-type lysozyme 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021010   Gene: ENSOGAG00000032320   Transcript: ENSOGAT00000029881
Sequence length 145
Comment pep:known_by_projection scaffold:OtoGar3:GL873601.1:3869137:3879632:-1 gene:ENSOGAG00000032320 transcript:ENSOGAT00000029881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASMVLSLIGFLVVPSGAPILGRCVVAKKLKEGGLDYFEGYSLENWVCLAYFESKFNPT
AVYENPQQGYTGFGLFQIRNNGWCGRGKNLCAVQCSALLNPDLKKTIECVKRIVKTKDGM
GSWPSWSHFCHYSDTLARWLDGCEL
Download sequence
Identical sequences H0XY17
ENSOGAP00000021010 XP_003794543.1.62490 ENSOGAP00000021010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]