SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021041 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021041
Domain Number 1 Region: 18-46,161-297,393-459
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000504
Family FAD/NAD-linked reductases, N-terminal and central domains 0.074
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000021041
Domain Number - Region: 285-320
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00414
Family FAD/NAD-linked reductases, N-terminal and central domains 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021041   Gene: ENSOGAG00000034472   Transcript: ENSOGAT00000029910
Sequence length 478
Comment pep:known_by_projection scaffold:OtoGar3:GL873566.1:1318423:1323801:-1 gene:ENSOGAG00000034472 transcript:ENSOGAT00000029910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPKKERLGASSLEPLPVIVIGNGPSGICLSYLLSGYTPYVKPDAIHPHPLLQRKLTEA
PGVSILDQDLDYLSEGLEGRCQSPMALLFDALLRPDTDVGGDMESVLTWKHQKERAIPHM
VLGRNLPGGAWHSIEGSMVTLSQGQWMGLPDLQVKDWMQKKRRGLRNSRATAGDIAHYYR
DYVAKKGLGHNFVSGAVVTAVEWETPESCNSGTQAPSPLFQVSGCLTAKDQSQQPFSLWA
RNVVLATGTFDSPARLGVSGEALPFIHYELSALEAARRVGAVTPSSDPVLIIGAGLSAAD
AVLYARHYNIPVIHAFRRPVDDPGLVFNQLPKMLYPEYHKVHQMMREQSILSPFPYKGYC
SLPGHRLLFFKEDNQAVFQDPQGIEKVFGISLVLVLIGSHPDLSFLPGAGADLAVDPDQP
LSARRNPIDVDPFTYQSTHQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP
Download sequence
Identical sequences H0XY48
ENSOGAP00000021041 XP_012661617.1.62490 ENSOGAP00000021041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]