SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021096 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021096
Domain Number 1 Region: 167-364
Classification Level Classification E-value
Superfamily E set domains 2.94e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000485
Further Details:      
 
Domain Number 2 Region: 61-183
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-20
Family Voltage-gated potassium channels 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021096   Gene: ENSOGAG00000031352   Transcript: ENSOGAT00000026143
Sequence length 391
Comment pep:known_by_projection scaffold:OtoGar3:GL873616.1:2661285:2666095:-1 gene:ENSOGAG00000031352 transcript:ENSOGAT00000026143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPSQNAFKKLIRVLTERMFKHLRKQFVTRFFGRSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFLFGLLWYVVAYIHRDLPEFHPAANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFNMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDARARVKRGYDNPNFILSEVNETDDTKM
Download sequence
Identical sequences H0XYA3
ENSOGAP00000021096 XP_003795943.1.62490 ENSOGAP00000021096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]