SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021106 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021106
Domain Number 1 Region: 156-222
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021106   Gene: ENSOGAG00000030783   Transcript: ENSOGAT00000024784
Sequence length 353
Comment pep:known_by_projection scaffold:OtoGar3:GL873656.1:56792:57967:1 gene:ENSOGAG00000030783 transcript:ENSOGAT00000024784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLLHAEEWAEVKELGDHHRHPQPHHLPQPPPPQPPATLPAREHPVYPPELSLLDSTDP
RAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEADGRGELVRRSSSCGGSSKSPGP
VKVREQLCKLKGGVVVDELGCGRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQ
LRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQQQPPPASCKGDHHHLRAT
ASYEGGAGTATAAGAQPASAGGQRPTAPGGCRTRFSAPATAGGYSVQLDALHFSTFEDSA
LTAMMAQKNLSPSLPGSILQPVQEESSKTSPRSHRSDGEFSPHSHYSDSDEAS
Download sequence
Identical sequences H0XYB3
ENSOGAP00000021106 ENSOGAP00000021106 XP_003798537.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]