SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021124 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021124
Domain Number 1 Region: 274-402
Classification Level Classification E-value
Superfamily Cyclin-like 2.67e-27
Family Cyclin 0.00095
Further Details:      
 
Domain Number 2 Region: 407-529
Classification Level Classification E-value
Superfamily Cyclin-like 5.74e-25
Family Cyclin 0.0033
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily F-box domain 0.0000000124
Family F-box domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021124   Gene: ENSOGAG00000028205   Transcript: ENSOGAT00000034742
Sequence length 789
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:8725248:8753696:1 gene:ENSOGAG00000028205 transcript:ENSOGAT00000034742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGGVVHCRCAKCFCYPMKRRVRRRPRSLTILSLPEDVLFHILKWLSVGDILAIRAVHS
HLKYLVDNHASVWACASFQELWPSPKNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSD
EGRAEVNGLKASHFFSLSERLNAGAAPFVWLFIRPPWSVSGSCCKAVVHESLRAECQLQR
THKASILHCLGRVLSLFEDEEKQQQARDLFEESANQGCLTSSYLLWESDRRTDMSDPGRC
LHSFRKLRDYAAKGCWEAQLSLAKACANGHQLGLETKVSSEIVCQLFQASQAVSKQQVFS
VQKGLNDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRYRLQLLGIACM
VICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIVSVLEGKIRVPTVVDYKEVLLTL
VPTAPRTQHLCSFLCELSLLHTSLSTYTPACLAATALLLARLTHGQTQPWTTRLWELTGF
SYEDLIPCVLSLHKKCFHDDAPKDYRQVSLTAVKQRFEDKRYEEISQEEVLSYGQLCATL
GVKQESPEPPSFLSTGDIHAFLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEETL
LGSFLDWSLDCCSGYEGDQESEGEKEGDVTAPSGILDVTLVYLNPEQHCCQESSDEEACP
EDKGGQDPHTPALGTQTPPNTGPEPPLQVRRELGKDSTTSGYSSLSSTSPTNSMDGSLGG
LPRPTSVLSLGSDSNTQPCHHQARKSCLQCHPLSPPESSVPWQQVKRKNLSMHSEEEEEE
DMNLGFLKL
Download sequence
Identical sequences H0XYD1
XP_003790853.1.62490 ENSOGAP00000021124 ENSOGAP00000021124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]