SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021129 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021129
Domain Number 1 Region: 548-925
Classification Level Classification E-value
Superfamily RNI-like 6.12e-67
Family 28-residue LRR 0.0000334
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily DEATH domain 2.47e-27
Family Pyrin domain, PYD 0.0039
Further Details:      
 
Domain Number 3 Region: 123-316
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000348
Family G proteins 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021129   Gene: ENSOGAG00000008477   Transcript: ENSOGAT00000008479
Sequence length 926
Comment pep:novel scaffold:OtoGar3:GL873593.1:1767046:1769826:-1 gene:ENSOGAG00000008477 transcript:ENSOGAT00000008479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSFFSDFGLMWYLEELNKKEFKKFKERFKQETLKLGLKQISWTEVKKSSRQELANLLI
QHYEAQQAWGLTLRIFHSMARQDLCDKVQRERAEHKKIYRAYVKNKFSSLCTSKFITDFF
ECFGEKVRPEELEYLHLLFAAKENGQPSHTTVLQGAEGIGKTTLLMKLLLGWAEGSLYED
RFLYAFYFCCRELRQLKETSLADLMSGNWPYPSPAPIAEIVSHPEKLLFIIDSFEQLKCD
LSEPESDLCSDWMKQQPVRVLLSGLLRKKMLPEASLLIAVTPMCPAELQARLVCPELITL
SGFSEEEIEFYFRRLFPSRSRAAEAFRFLRENAQVYSLCHTPRVCWVIGTCMKQVMEKGR
SLAPICRRLTSLYASFILNLFTGEDASCPSPESQVQLRGLCSLAVEGMWTDEFEFNDEAL
RRNGIADSDVPALLDTNIFLKCTESSYTFAHTSIQEFCAAMFYLLRRDHPNPAVRCRETL
LATHLKKVKKAHWTYWVRFLFGFLKEKEQEEVDTFFGFQPSQEIRQEFHQILKNLGEHEG
LPGQTDFLALFYCLFELEDTTFVREAVNFLQEINFSINNDLDLVVCAYCLEYCSGLRRLS
FSVPKVIEEDGQGCASGPSVTHWHHIFSVFTTNEHLKELEITDTDFCQSVLVILCNQLRH
PTCHLEKLQLNRVSLSGGSSVFFEALSQSPDLRYLNLHNVNLSRDDMEKFCKVLSLSMCN
IEELTLSGCFLRNPCWDLLHEALLTKKSLCSLDLSASNLHDKGLNVLSVALRHPDCCLRS
LGLANCSFTAVGCGDLATVLTSNRKLTSLQIGLNKVGDMGAKVLCEALARPSCHLEILGF
KDCGLTSACCRDLYSALTHSRTLRVLDLTLNTLDYSGVAVLCEALKYPECPLWVLGLPKT
RFDEKTEMLLMAVEESNPHLTIIGFW
Download sequence
Identical sequences H0XYD6
ENSOGAP00000021129 ENSOGAP00000021129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]