SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021144 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021144
Domain Number 1 Region: 65-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021144   Gene: ENSOGAG00000030530   Transcript: ENSOGAT00000028189
Sequence length 198
Comment pep:known_by_projection scaffold:OtoGar3:GL873587.1:5039135:5044221:1 gene:ENSOGAG00000030530 transcript:ENSOGAT00000028189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAPVPPMPGPALPALLGAPQAEVLEEVLREQFGPLPQLAAICRLKRLPSGGYSSTEDL
QLVLERRRVANAKERERIKNLNRGFAKLKALVPFLPQSRKPSKVDILKGATEYIQVLGDV
LEGAKESKKQDSDEQNYSNNTSAREPSRNITQHASCAVGLKNEEEGPWADGGSGETAFAC
RQSCLTSMIGVISPTRSL
Download sequence
Identical sequences H0XYF1
ENSOGAP00000021144 ENSOGAP00000021144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]