SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021179 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021179
Domain Number 1 Region: 225-301
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-16
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021179   Gene: ENSOGAG00000034883   Transcript: ENSOGAT00000028590
Sequence length 365
Comment pep:known_by_projection scaffold:OtoGar3:GL873632.1:883022:884119:1 gene:ENSOGAG00000034883 transcript:ENSOGAT00000028590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGLHLGAAAAGEDDLFLHKSLSASTAKRLEAAFRSTPPGMDLSLAPPPRERPASSSSS
PLGCFEPADPEGAGLLLPPPGGGGGSTGSGGGGGGVSVPGMLVGSAGVGGDPSLSSLPAG
AALCLKYGENASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGSGGAKAAE
GCSNAHLHGGASVPPGGPGGGGGSSSGGGGSGGGGSSSKKSKEQKALRLNINARERRRMH
DLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQAI
SAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLPPAASCPEKCALFNSVSSSLCKQ
CTEKP
Download sequence
Identical sequences H0XYI6
ENSOGAP00000021179 ENSOGAP00000021179 XP_003797280.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]