SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021241 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021241
Domain Number 1 Region: 60-142
Classification Level Classification E-value
Superfamily F-box domain 1.3e-17
Family F-box domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021241   Gene: ENSOGAG00000004252   Transcript: ENSOGAT00000031923
Sequence length 563
Comment pep:known_by_projection scaffold:OtoGar3:GL873704.1:1125261:1172215:-1 gene:ENSOGAG00000004252 transcript:ENSOGAT00000031923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVCARLCGVGPSRGCRRRQQRRGPAETAAADSEPDTDPEEERIEAGEATQAGAGGGPCA
GPSPSPPRCSLLELPPELLVEIFASLPGTDLPSLAQVCTKFRRILHTDTIWRRRCREEYG
VCENLRKLEITGVSCRDVYAKRINPRVKSGRFMRILPDYEHMEYRDVYTCLLHRYRHILG
LWQPDIGPYGGLLNVVVDGLFIIGWMYLPPHDPHVDDPMRFKPLFRIHLLERKSATVECM
YGHKGPHNGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQ
ELILMKFIYTSQYDNCLTYRRIYLPPSGPDDLIKPGLFKGTYGSHGLEIVMLSFHGQRAR
GTKITGDPNIPAGQQTVEIDLRHRIQLPDAEGLRDFNELSRIVLEVRERVRQEQQEDGRE
AGGSRGQQGSRELQPPGRGLGGVPAEDGGEPGDVAAAAEQPVQSGPGQPFVLPAGVSSRN
EDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFVLFDEDRFGFLWLELKSFSLYSRVQVTF
RNAEAPSPQAFDEMLKNIQALTS
Download sequence
Identical sequences H0XYP8
ENSOGAP00000021241 ENSOGAP00000021241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]