SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021255 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021255
Domain Number 1 Region: 261-437
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-24
Family DBL homology domain (DH-domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021255   Gene: ENSOGAG00000029961   Transcript: ENSOGAT00000032689
Sequence length 872
Comment pep:known_by_projection scaffold:OtoGar3:GL873614.1:2309886:2367006:-1 gene:ENSOGAG00000029961 transcript:ENSOGAT00000032689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKTKTKPGENEHMPVNNPSTQIYQLQALASELKTGFTEAMQELSRIQHGEYALEEKVKS
CRCSMEEKVTEMKNSLNYFKEELSNAMSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKA
KKTQKEEHSSQVGPAQAQGSPFRSINIPEPVLPSEDFTNILPSQAYEKAQESRPVHVGDS
NVKGMMGPGVNPTPPETEENLKSCLSTDIPSKGHLPSGMWRQPKDGKEWGDEYVTKDHPD
KLKEAGQGRHSSLENVLCETSLAAKRQTVALELLESERKYVINISLILKIKATFQGSDGK
RNSKERSLFPGSLRYLVQQHLDLLHALQERVLKWPRQGVLGDLFLKLTNDENNFLDYYVA
YLRDLPECISLVHVVVLKEGDEEIKSDIYTLFFHIVQRIPEYLIHLQNVLKFTEQEHPDY
YLLLVCVQRLRVFISHYTLLFQCNEDLLIQKRKKLKKSSMAKLYKGLASQCANAGQDASP
TAGPEAVRDSGIHSEEMLQPYPSAPSSGPGVTHLMPPPKKSQQQQSLMESMQPGKPSDWE
IEGRKHERPESLLAPAQFCAAEQDVKALAGPLQAIPEMDFEPSPAEPLGNVERSLRAPAE
LLPDARGFVPAGYEEFEYGGEIFALPAPYDEESFQAPTLFENCSPASSESSLDICFLRPV
SFAMEAERPEHPMQPLPKSATSPASSSGAYKLEAAAQAQAHGKAKPLSRSLKEFPRAPPP
EGVAPRLYSTRSSSGGRAPLKSERAAQPHGPAAVAAAARGAPRTFFPQQRSQSEKQTYLE
VRREMHLEDATRFCPKEERESEQTSFSDQNPRQDQKGGFRSSFRKLFKKKSSGSEYREKT
NENPSMDPSPTKQDFFRNRLALANDLDQGTAV
Download sequence
Identical sequences H0XYR2
ENSOGAP00000021255 XP_003795718.1.62490 ENSOGAP00000021255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]