SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021263 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021263
Domain Number 1 Region: 12-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-40
Family Forkhead DNA-binding domain 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021263   Gene: ENSOGAG00000007643   Transcript: ENSOGAT00000007647
Sequence length 325
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:12359595:12360602:1 gene:ENSOGAG00000007643 transcript:ENSOGAT00000007647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNS
LRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPS
KPTDAAQYLQQQAKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREY
KMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPISMTSGDYSA
YGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTAT
SQSSPATPSETLTSPASALHSVAVH
Download sequence
Identical sequences H0XYS0
ENSOGAP00000021263 XP_003784441.1.62490 ENSOGAP00000021263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]