SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021286 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021286
Domain Number 1 Region: 381-636,665-746
Classification Level Classification E-value
Superfamily ARM repeat 9.72e-38
Family Plakophilin 1 helical region 0.086
Further Details:      
 
Domain Number 2 Region: 103-301
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000126
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021286   Gene: ENSOGAG00000029199   Transcript: ENSOGAT00000026241
Sequence length 756
Comment pep:known_by_projection scaffold:OtoGar3:GL873585.1:970:61084:1 gene:ENSOGAG00000029199 transcript:ENSOGAT00000026241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFLHPGLLPRNIVPPDARKDALGCCVVQEEASPYSLVNICLNALVANLEKLCSKRPDG
TLCLPEHWSFPQGIADRFVGVLTWQGKLTDRTASICQGNQMKLKLVNIQKAKISTAAFIK
AFCHHKLIELDATAVHADLPIPDIISGLCSNNWIQQNLQCLLLDSTSVPQGSRLPSFGQL
TGLRILSVFNVRFHTEDLANVSQLPRLESLDISNTLVTDISALLTCRDRLKSLTMHYLKC
LAMSKPQILAVIRELKCLFHLDISDHRQLKSDLAFHLLQQKDILPNIVSLDISGGNWISD
GAVERFIRQRPAMQFVGLLATDAGYSDFFTTEQGLRVAGGANMNQITEALSRYRNRSCFM
KEALYRLFTETFSMQVTMPAILKLVAVGMRNHPLDLPVQFTASACALNLTRQGLARGMPV
RLLSEVTCLLFKALKNFPHYQQLQKNCLLSLTNSRILVDVPFDRFDAAKFVMRWLCKHEN
PKMQTMAVSITSILALQLSPEQTVQLKEELFVAVKELLAIVKQKTTENLDDVTLLFALKA
LWNLTDESPAACKHFVENHGLTIFTQVLETFSESAIQSKVLGLLNNVAEVRELSSRLLSD
DMVKHISSLLHSKEMEVSYFAAGIVAHLTSDSQTWLARDFQRSALLQDLHATIQNWPSSS
CKMTALVTYRSFKAFFPLLGNFSQPEVQLWALWAMYHVCSKNPSKYCKMLVEEGGLQLLC
DIQEHREANPQAQQIAASIIDDFRMHFMNYQRPPLC
Download sequence
Identical sequences H0XYU3
ENSOGAP00000021286 ENSOGAP00000021286 XP_003793147.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]