SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021328 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021328
Domain Number 1 Region: 459-534,601-783
Classification Level Classification E-value
Superfamily RNI-like 5.63e-25
Family 28-residue LRR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021328   Gene: ENSOGAG00000033806   Transcript: ENSOGAT00000026022
Sequence length 814
Comment pep:known_by_projection scaffold:OtoGar3:GL873729.1:736013:760695:-1 gene:ENSOGAG00000033806 transcript:ENSOGAT00000026022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALEAWRAQSCWFCEVAAATTMEATSREAAPAKSSASGPNAPPALFELCGRAVSAHMGV
LESGVWALPGPILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLES
VTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELV
AEPNRRVLETLASSLHTLKFRHPLFSDVAAQQSLRQLLHQLIHHGAVNQVSLYNWPVPES
AFFILILTMSAGFWQPGPGGSPCRLCGEASRGRAPSRDEGSLLLGSRRPRRDAAERCAAA
LMATRRKSEAKQMPRAAPTARVTRRSTQESLTAGGTDPKRELYPPATSHEAPGTKRPPST
PATTSFASASSSTSSFKRAPASSAPQPKPLKRFKRAAGKKGARTRQGSGAESEDLYDFVF
IVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSMEAAL
TLCHLLSSWVSLESLTLSYNGLGSNIFRLLDSLRALSGQAGCRLRALHLSDLFSPLPILE
LTRAIVRALPLLRVLSIRVDHPSQRDNPAVPGNAGPPSHIVGDEEIPENCLEQLEMGFPR
GAQPAPLLCSVLKASGSLQQLSLDSATFASPQDFGLVLQTLKEYNLALKRLSFHDMNLAD
CQSEVLFLLQNLTLQEITFSFCRLFEKRPAQFLPEMVAAMKGNSTLKGLRLPGNRLGNAG
LLALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLFQNWLDQDA
VTAREAIRRLRATCHVVSDSWDSSQAFADYVSTM
Download sequence
Identical sequences H0XYY5
ENSOGAP00000021328 ENSOGAP00000021328 XP_003801464.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]