SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021363 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021363
Domain Number 1 Region: 92-315
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-24
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021363   Gene: ENSOGAG00000025849   Transcript: ENSOGAT00000034689
Sequence length 472
Comment pep:known_by_projection scaffold:OtoGar3:GL873675.1:2347653:2359536:1 gene:ENSOGAG00000025849 transcript:ENSOGAT00000034689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVQRTWWQQWRDPANVKRLRWGRAQEYCMGSGGAVAALKDPPLPLRTTHDAYNRTEEH
VLINRHDITSRKDAWDMQEFITGMYVKQLLQHPLFQLLLAVLLVINAITIALRTNATLHQ
QHYELFSTIDDIVLSILVCEVLLGWLNGFWIFWKDGWNILNFAIVFMLLMGFFVNELSVI
SINYTLRALRLIHVCMAVEPLARIIRVILQSVPDMANIMALILFFMLVFSVFGVTLFGAF
VPKHFQNMQVALYTLFICITQDGWVDIYSDFQTDKREYAMQVGGAIYFAIFITIGAFIGI
NLFVVVVTTNLEQMMKAGKEERQNQIKFNEMDSEEEKETETDLPLVHCLVARSEKAEVPQ
EPLMGGFLSNLSENTCDNFCLVLEAIQENLVQYKEIRDELNTIVEEVRSIRFNQEQEEER
LHKHVSMSVSLESGSSLDIRKMSQQQDLLTALVNMDKVHESSTSILKHKNSR
Download sequence
Identical sequences H0XZ20
ENSOGAP00000021363 ENSOGAP00000021363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]