SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021376 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021376
Domain Number 1 Region: 466-664
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.8e-69
Family Hemopexin-like domain 0.00000000175
Further Details:      
 
Domain Number 2 Region: 88-218,393-448
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.23e-37
Family Matrix metalloproteases, catalytic domain 0.00000034
Further Details:      
 
Domain Number 3 Region: 279-336
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-22
Family Fibronectin type II module 0.0000617
Further Details:      
 
Domain Number 4 Region: 339-395
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-21
Family Fibronectin type II module 0.0000733
Further Details:      
 
Domain Number 5 Region: 225-278
Classification Level Classification E-value
Superfamily Kringle-like 1.71e-19
Family Fibronectin type II module 0.0000699
Further Details:      
 
Domain Number 6 Region: 42-107
Classification Level Classification E-value
Superfamily PGBD-like 6.59e-19
Family MMP N-terminal domain 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021376   Gene: ENSOGAG00000030370   Transcript: ENSOGAT00000028749
Sequence length 664
Comment pep:known_by_projection scaffold:OtoGar3:GL873577.1:7915749:7941113:1 gene:ENSOGAG00000030370 transcript:ENSOGAT00000028749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARVAWGALVGALRALCILSCLLGRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQSTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSGVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQAPVVRVKYGNADGEYCKFPFL
FNGKEYNSCTDTGRSDGFLWCSTSYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQ
GKSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGSPCVFPFTFLGN
KYESCTSAGRSDGKMWCATTASYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPG
ALMAPIYTYTKNFRLSQDDIKGIQELYGASPDTDIDTGTGPTPTLGPVTPEICKQDIVFD
GIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFA
GNEYWVYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKK
KMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSD
WLGC
Download sequence
Identical sequences H0XZ33
ENSOGAP00000021376 ENSOGAP00000021376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]