SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021379 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021379
Domain Number 1 Region: 101-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021379   Gene: ENSOGAG00000025613   Transcript: ENSOGAT00000031568
Sequence length 356
Comment pep:known_by_projection scaffold:OtoGar3:GL873567.1:4811553:4815599:1 gene:ENSOGAG00000025613 transcript:ENSOGAT00000031568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSYSESGLMSEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEE
DEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPT
TNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVF
HVKPPPHAYSSALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSSEFEKNYAFT
MHYPAATLAGAQSHGSIFSGAAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
Download sequence
Identical sequences H0XZ36
XP_003791512.1.62490 ENSOGAP00000021379 ENSOGAP00000021379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]