SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021399 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021399
Domain Number 1 Region: 12-93
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000000774
Family Snake venom toxins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021399   Gene: ENSOGAG00000032652   Transcript: ENSOGAT00000026062
Sequence length 127
Comment pep:known_by_projection scaffold:OtoGar3:GL873810.1:94211:95661:1 gene:ENSOGAG00000032652 transcript:ENSOGAT00000026062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAILLLFAALAVAVGPARALRCHVCVSSTDCKHPQECSPSSNFCKTITTVESLSGNLVK
KECTEKCVPIQTQQGQLSSSTAIQCCQGDLCNERQTSAAPARAPLSHTILSLGLAWGLLA
LLLAPNL
Download sequence
Identical sequences H0XZ56
ENSOGAP00000021399 ENSOGAP00000021399 XP_003803323.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]