SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021540 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021540
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.4e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0055
Further Details:      
 
Domain Number 2 Region: 305-481
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000609
Family FAD/NAD-linked reductases, N-terminal and central domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021540   Gene: ENSOGAG00000032561   Transcript: ENSOGAT00000024241
Sequence length 536
Comment pep:novel scaffold:OtoGar3:GL873535.1:25299907:25319105:-1 gene:ENSOGAG00000032561 transcript:ENSOGAT00000024241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKRIAVIGAGVSGLGAIKTCLEEGLEPTCFEGSDDIGGLWKYVEKIEHDRPSIYKSVT
SNTSKEMMAYSDYPFSDHFPNYLHNSKIMEYLRMYVKHFHLMKHIQFLTKVCSVKKRSDF
SCTGQWDVVVETEGKQRSYVFDGVMVCTGLFTHPSLPLENFPGMKRFKGQYIHSKEYKSP
EKFREKKIIVVGIGNSGVDLAIELSHVASQVFLSTRRGTWIWKRVWDHGMPMDTVLFTRF
NSIVCEFCPLFLINRWAENKLNVQFNHELYGLQPRHRFLNHQATFGDDLPNHIISGRVLI
KPNVREFTETSAIFEDDTEEDIDVIIFATGYTLSFLFLEDDSKILDSQHSMFKFVFPPQL
EKPTLAFIGIIQPVGATIPTAEIQSRWAVRVFKGLNKLPSESSMMADIRKMRGFRFLNGP
RVTYGRVPYVDYMDEIASEIGVKPKPLSLFLWDPLLAKEVLLGPCTPFQYRIQGPGKWVG
ARGAILTQRAWIIKPLKTRVLACHQPPLSMPFWLKSVCATFFLLVLTLVVVKGRSH
Download sequence
Identical sequences H0XZJ7
ENSOGAP00000021540 ENSOGAP00000021540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]