SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021563 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021563
Domain Number 1 Region: 43-99
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 107-159
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000353
Family Hairy Orange domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021563   Gene: ENSOGAG00000030877   Transcript: ENSOGAT00000031833
Sequence length 328
Comment pep:known_by_projection scaffold:OtoGar3:GL873663.1:3514072:3526300:1 gene:ENSOGAG00000030877 transcript:ENSOGAT00000031833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPREPSSSDGESDGPIDVGREGELSQMARPLSTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALALDFRSIG
FRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFF
HSCPGLPALSSQLAILGRVPGPVLPGASSPAYPIPALRSTPIRRAAGTILPARRNLLPTR
GASSTRRARPPERPAAPMPLAPSSRAARSSHITPLLQSSSPTPPGAVRPAAYVAVPTSSP
SSPGPAGRPAGAMLYHSWVSEITEIGAF
Download sequence
Identical sequences H0XZM0
XP_003799041.1.62490 ENSOGAP00000021563 ENSOGAP00000021563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]