SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021579 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021579
Domain Number 1 Region: 100-321
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-30
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021579   Gene: ENSOGAG00000025257   Transcript: ENSOGAT00000034575
Sequence length 1156
Comment pep:known_by_projection scaffold:OtoGar3:GL873621.1:2182984:2361246:-1 gene:ENSOGAG00000025257 transcript:ENSOGAT00000034575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRYIEENEDDGGEWRRRACTSEIQTGFILSSFATFLGGLFILYLFRLIRRSLIKWENIK
GTGIILKLVTSETFYQPYDRKLHFRGIFRDRIEMLLSAQTFVGQVLVILVFLLSIGSLII
YFINSTDPVGRCASYEDNTIPIDLIFNAFFSFYFGLRFLAADNKIKFWLELNSIVDIFTV
PPTFISFYLKSNWLGLRFLRALRLLELPQIMQILGALKTSNSVKFSKLLSMIFSVWFTAA
GFIHLVENTGDPWLKGTNSQNISYFDCFYLVMATTSTVGFGDVVAKTTLGRTFIMVFTLG
SLILFANYVPEMVELFANKRKNTTCYEVVKGKKFIVVCGNITVESVTAFLRNFLRHKSGE
INTEIVFLGESPPSLELETIFKCYLAYTTFVFGSARKWEDLKRVAVRTSFIFSPVSFPNY
CKQTKQEEIPSITALGIQIPYYCSDSTTTTKILSSSKVYLPKIPTWNWITGDNIICFAEL
KLGFIAQGCLVPGLCTFLTSLFVEQNKKIFPKKSWKKLFLNGMKNKIFTQRLSDDFVGMS
FPEVALLCFMKMHLMLIAIEHKSFIQSGYCGLVLNPPAQIRLQRNTVGFFIADSLKKVRR
AYLYCSICHSDVYSPEQIAKCGCKGKIRRHMTVMSVKRCKRFTECMKAFFTSVNPQDSRK
RVSDQLSSTQSFKLSTAMHDFDQDTDPLDSSGMFHWCRSTPLDKMVLKRTEKSKHEFQNH
IVACVFGDAHSTLLGLRNFVMPLRTSNYTRQELKDIVFIGSLDYLQREWQFLRNFPQVYI
MPGSALYAGDLHAVNIEKCFMCAVLCPPSKPSSSHTLVDTETIMATLNIGSVRVNTSSKP
FSVADNISIYSNEPSGKSKHRRVPFLTELKNPYNIHFIEQLGGLEEAMPGTDLHLSTSFA
TGTVFSDSFLDSLLATAFYNYRVLELLQMLVTGGVSSQLEQHLDKEKYSNADSYTTIMTG
KSRCKLELLPLHQTILSDVEPKKNFGQLFCGSLDRFGILCIGLYRLINEEELNPESKRFV
ITRPENEFLLLPTDLVYCAIPFSLDCNQKKDAETDGMPYETVNIEPLTPEKSPDAKHPSK
TDIIKETTSPTVQVPVQPLQSGIFAPKQDVLKQSSKNTIQSSQVLPGDNVQEKASPEMAT
SNKENENGSRPFLCPL
Download sequence
Identical sequences H0XZN6
ENSOGAP00000021579 ENSOGAP00000021579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]