SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021585 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021585
Domain Number 1 Region: 1160-1315,1353-1432
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-41
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1483-1680,1707-1732
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-37
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 711-858,892-939
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.2e-33
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 127-272,361-430
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.61e-29
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021585   Gene: ENSOGAG00000008312   Transcript: ENSOGAT00000035086
Sequence length 1907
Comment pep:novel scaffold:OtoGar3:GL873537.1:15925914:15952873:1 gene:ENSOGAG00000008312 transcript:ENSOGAT00000035086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLATLVPLGPECLRPFTRESLAAIEQRAVEEVARQERNRQMEIEEPERKPRSDLEAGKN
LPLIYGDPPPEVIGIPLEDLDPYYSDKKTFIVLNKGKAIFRFSATPALYLLSPFSIIRRG
AIKVLIHALFSMFIMITILTNCVFMTMSDPPPWSKNVEYTFTGIYTFESLIKMLARGFCI
DDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNISALRTFRVLRALKTITVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVRWPPPFNDTNITWYGNDTCDTW
ISNDTWAGNYTFDWEAYISDEGNFYFLEGSNDALLCGNSSDAGHCPEGYECIKAGRNPNY
GYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILA
VVAMAYAEQNEATLAENKEKEEEFQQMLEKFKKHQEELEKVWTQEEEEAKYSGLSLSWSL
GSPGRAKGQGRPGSGRWRGRWGPSPWQRLQWQPGCLNRGEGSPEAELQRRQWHLGCYGRL
PPVPRPPRKSQERNKDAVMRGARTDTHREGWVDGWTGAGRGRWMNGWMRGREGKRSTARE
AGEPLGGSLTAPQWHQPDACGTGTQVPAVASHLSLASLEPSQESGCLTCQAGGGVGVQPS
SLSTTPPPELEEAHQKCPPWWYKCAHKVLIWNCCVPWVKFKNIIHLIVMDPFVDLGITIC
IVLNTLFMAMEHYPMTEHFDNVLSVGNLVFTGIFTAEMVLKLIALDPYEYFQQGWNVFDS
IIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVL
AIIVFIFAVVGMQLFGKSYKECVCKIASDCSLPRWHMHDFFHSFLIVFRILCGEWIETMW
DCMEVAGQPMCLTVFLLVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIG
RIKWGIGFAKAFLLGLLHGKILSPQDIMLRLGKPGGAEEAEEAGESDPKDEKEPLPEEDL
KKDNHILNHVGLADGPPPSIELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFPRL
QKQLKPLYDGDSSVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRYPCLTVDIS
QGRGKMWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILEYADK
VFTYVFILEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRT
LRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCI
NTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIM
YAAVDSREQEQQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGKDI
FMTEEQKKYYNAMKKLGSKKPQKPIPRPQNKVQGMVYDLVTNQVFDIAIMILICLNMVTM
MVETDDQSQLKVDILYNINMIFIIIFTGECLLKMLALRQYFFTVGWNIFDFVVVILSIVG
LALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLF
LVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGP
PDCDPDLENPGSSVKGDCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSE
PLCEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVP
GDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVC
AIKIQRAYRRHLLQRSVKQASYMYRHSQDSNGDDAPEKEGLIANTMN
Download sequence
Identical sequences H0XZP2
ENSOGAP00000021585 ENSOGAP00000021585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]