SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021594 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021594
Domain Number 1 Region: 152-241
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.53e-33
Family Inhibitor of apoptosis (IAP) repeat 0.000086
Further Details:      
 
Domain Number 2 Region: 259-366
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.75e-31
Family Inhibitor of apoptosis (IAP) repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 1085-1431
Classification Level Classification E-value
Superfamily RNI-like 9.61e-24
Family Cyclin A/CDK2-associated p19, Skp2 0.012
Further Details:      
 
Domain Number 4 Region: 47-134
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.57e-23
Family Inhibitor of apoptosis (IAP) repeat 0.00094
Further Details:      
 
Domain Number 5 Region: 478-658
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000136
Family Tandem AAA-ATPase domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021594   Gene: ENSOGAG00000026197   Transcript: ENSOGAT00000025651
Sequence length 1439
Comment pep:known_by_projection scaffold:OtoGar3:GL873536.1:5811612:5845197:1 gene:ENSOGAG00000026197 transcript:ENSOGAT00000025651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPKQAPQERISQFDYAWLSEVSPLMGLDAISFAKNLEEEEQSYRVTMQKGYNAQMRSE
ARRLKTFETHPQDGSWTPQEMAAAGFYFTGVKTGIQCFCCSLILFGTSLRRVPIEDHKTF
HQDCEFLLSRDVGNIGKYEVRVKSPEKKLRRDKARYKEEEARLESFKNWPFYAQATSPRA
LSAAGFVFTGERDTVQCFSCSGCLGNWEEGDDPWKEHAKWFPKCEFLQRKKSSEEIAQYI
QSYKGFVDVTGEHFMNSWVKRELPMASAYCNDSVFANEELRLDSFKNWPQESSAGVAALA
KAGLFYTGIKDIVQCFSCGGCLENWKEGDDPLEDHTKYFPNCQFIQNMKSSAEVIPGLQN
HVELCELMESTSESNLEDSAADSSILPGKKLEVAYGFYVCRKLNVTETVEGPKTSLAPFL
LSTEMAQGEPQWFQEAKSLNEHLRAAYLNASFRRLSLLEISSGLATDHLLGCDLSIVSKD
ISNLVQEPLVLPEVFTKLNSVMCVEGEAGSGKTIFLKKIAFLWASGCCPFLNRFQLVFYL
SLSATRPGQGLADIISDQLLEKEGSVTEMCLRNIIQQLRNQVLFLLDDYKEMGSVPQDVE
RLIQKNHSSRTCLLIAVRTNRARDIRRYLDTILEIKAFPFYNTICILRKLFSHNMARLLK
FRIYFGRQKNLQESHKTPLFVAAVCANWFQYPFDPSFDDVAVFKSYMECLFLRHKTTIEL
LQATVSSCGELALKGFFSSCFEFSDDDLEEAGVDEDGDLTMCLMSKFTAQRLRPVYQFLS
PPFQEFLAARRLIELLDSDRQADQDLGLYYLKQINSSMMALKPYNNFLNYISNCPLTKAG
PKIVSHLLHLVDDKESLENVSENDDYLKHRPEISQEMVFIRRFWQMAPQAYFSLVSNHLL
GLALKIAYQSNTVAACSSLILQFLQGRTLSLDVLKLQYFFDYPESLPLMRSIQVSIRGNK
HPRRADFSVLETCLDKSQAPTIDQDYTAAFQPMKEWEQNLAEDEDMVESYMAIRHTAPPD
ISTGYWKLSPKQYKIPLLEVHVTNADAIDQEMLKVLMTVFPASQHIELHLTHSSGIIESI
RPALELHKASVTKCSIDKCELSVAEQELLLTLPSLESLELTGTIQVLLQSYYSFYVYLYK
YPYCVNVKHKCRDIRLLNLKVTFLSVNENLQSSLISENPSYFTVRLIQNSPNLHVFHLKC
NFFSDFESLMTVLSSCKKLKEVKFSGSFFQSIPFVAILPNFISLKILNVGNQQFPDKETS
EKFAYTLGSLKNLEELILPTGDGIHQVAKLIVQQCRQLQRLRVLSFFQTLDDDSVMEIAK
VAVDGGFQKLENLNLSINHKITEEGYRNFFQALDNLPNLQELSITRNYTHCIKAQATTVK
SLSQCVLRLPSLTTLHMLSWLLDAEDIALLNVMKERHPQSKHLNIFWKWILPFSPIIQK
Download sequence
Identical sequences H0XZQ1
ENSOGAP00000021594 ENSOGAP00000021594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]