SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021826 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021826
Domain Number 1 Region: 6-181
Classification Level Classification E-value
Superfamily Ferritin-like 1.03e-67
Family Ferritin 0.000000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021826   Gene: ENSOGAG00000026278   Transcript: ENSOGAT00000033402
Sequence length 185
Comment pep:novel scaffold:OtoGar3:GL873591.1:6227408:6227962:1 gene:ENSOGAG00000026278 transcript:ENSOGAT00000033402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEQTVMATAPSQIRQNYHPECEASVNRLINLQLYASYVYLSMAFYFDRDDVALKHFTRFF
LRKSHQQQADAERVMELQNQRGGRICLRDLKKPDRDDWENGLRALECAFQLEKSVNQSFL
DLHQLASDKGDPQLCSFLETCFLDDQVKILKELSGYLADLHKLGAPESRMAEYLFDKLSL
GSSDD
Download sequence
Identical sequences H0Y0D3
ENSOGAP00000021826 ENSOGAP00000021826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]