SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021846 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021846
Domain Number 1 Region: 192-379
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-50
Family DBL homology domain (DH-domain) 0.0000115
Further Details:      
 
Domain Number 2 Region: 387-513
Classification Level Classification E-value
Superfamily PH domain-like 6.87e-30
Family Pleckstrin-homology domain (PH domain) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021846   Gene: ENSOGAG00000034795   Transcript: ENSOGAT00000033793
Sequence length 621
Comment pep:known_by_projection scaffold:OtoGar3:GL873562.1:12018074:12025100:1 gene:ENSOGAG00000034795 transcript:ENSOGAT00000033793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPDRPRPAPGRTDRILGVMGGMLRACALPGPEGPPKRSPLGQEGTEPESDCTEGDQRG
DREREGLAWAPQPEPYSIAGSEGSISASAASGLAAPSGPSSGLSSSPCSPGPPGPVRGLR
RWLDHSKHCLSVETEADRGQAGPYENWMLDPALATGEELPELTLLTTLLEGPGNKTQQPE
EETLSQAPESEEEQKKKALERSMYVLSELVETEKMYVDDLGQIVEGYMATMTAQGVPESL
RGRDRIVFGNIQQIYEWHRDYFLQELQRCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKS
EHVVSEFGDSYFEELRQQLGHRLQLSDLLIKPVQRIMKYQLLLKDFLKYYGRAGMDTEEL
EQAVEVMCFVPKRCNDMMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSSRGRER
RVFLFEQIVIFSEALGGGIRGGTQPGYVYKSSIKVSCLGLEGNLQGDPCRFALTSRGPEG
GIQRYVLQAADPAISQAWIKQVAQMLETQRDFLNALQSPIEYQRRESQTNSLGRPGGPWV
GSPGRIRPGDRAQGSTHIPINGSLPSLLLLPKGETARAPPPPDTQTLSDIPQPSHDSPPV
PPTPNTPLCQARLAKLDEDEL
Download sequence
Identical sequences H0Y0F3
ENSOGAP00000021846 ENSOGAP00000021846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]