SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021848 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021848
Domain Number 1 Region: 538-568,667-746
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000824
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021848   Gene: ENSOGAG00000032822   Transcript: ENSOGAT00000031403
Sequence length 763
Comment pep:known_by_projection scaffold:OtoGar3:GL873698.1:869039:881470:-1 gene:ENSOGAG00000032822 transcript:ENSOGAT00000031403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSEASGPRDTQALLSTTQAMELRRRDYHVERPLLNQEQLEELGHQGSVPGTHQWRTWL
QCSHARARALLLQWLPVLAWLPQYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVLIYFLFGTSRHISVGTFAVVSVMVGSVTESLAPNERYLQASNSTVNETAR
DADPVQVASTLSVLVGLFQVGLGLVHFGFVVTYLSEPLVRAYTTAASVHVFVSQLKYVFG
LHLSSHSGPLSLIYTVLEVCWKLPQSVVGTVVTAAVAGVVLVVVKLLNNKLQQHLPIPIP
GELLTLIGATGISYGVGLKHRFGVDVVGNIPAGLLPPKAPSPKLFTKLLGNAFTIAVVGF
AIAISLGKTFALRHGYRVDSNQELVALGLSNFVGGIFQCFPVSCSMSRSLVQESSGGNTQ
VAGAVSSLFILLIIIKLGELFQDLPKAVLAATIIVNLKGMLMQFTDICSLWKANRADLLI
WLATFVATILLNLDLGLMVAVVFSLLLLVVRTQLPHYSVLGQLPGTDIYRDVAEYSEARE
VPGVKIFRSSTTVYFANAEFYSDTLKQRCGVDVDHLISQKKLLLRKQEQLRLKQVRKEKK
LQKQAASSKDTSVSINVNTSLKDIKSHNLEDSKPKQVSPGNKLEDTASSGQEDAKAPDMS
TLKALGLPQPDFHSLVLDLGALSFVDTVCLKSLRNIFHDFQEIEVEVYMAACHSPVITQL
EAGHFFDASITKKHLFASVHDAVTFALQHPKSGPDSPVLVTKL
Download sequence
Identical sequences H0Y0F5
ENSOGAP00000021848 ENSOGAP00000021848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]