SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021901 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021901
Domain Number 1 Region: 384-629
Classification Level Classification E-value
Superfamily RNI-like 2.22e-27
Family 28-residue LRR 0.0037
Further Details:      
 
Domain Number 2 Region: 130-217,246-300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000706
Family Nucleotide and nucleoside kinases 0.048
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000021901
Domain Number - Region: 63-157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00084
Family Nucleotide and nucleoside kinases 0.048
Further Details:      
 
Domain Number - Region: 330-409
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.051
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021901   Gene: ENSOGAG00000026488   Transcript: ENSOGAT00000028006
Sequence length 629
Comment pep:novel scaffold:OtoGar3:GL873526.1:19685645:19687961:-1 gene:ENSOGAG00000026488 transcript:ENSOGAT00000028006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRLEVEEANGKELADVLIDRSPQILDRGVVNSSEKMNLTDLSKMAKGQIPGSAQGQGKMA
ELEDTDTEDDLDVEMSGKKEECRNITEILPLLRKNKFQLVGSDNFLASVIQRSQKFIPFL
QPRIAPQPIAHTVVLYGPAGVGKSTLAKQVFLDWAENNLNQMFNYVFYLRCKELNHVGAC
SFAELIFKDWPEWLGCAAEVFGQAQKILFIIDGFEELRVPAGALIHDICGNWEREMPVPV
LLGSLLKRKMLPKASLLVTTRPEALRELRLLVEQPLFIEMEGLLEPDRRAYFLRQFADQD
QALRALDLMKGNVVQKLFSKEERVRNPSLTQVGYFLFGLSNEKRVQELESTFGCRMSLQI
REELLKYRANLDENKPFSRTDMKELLYCLYESQDEGLMRDAMVPFTEVSLHWMNTFEVMY
SSFCLKHCQNLQKLSLQIARGIFLENDPVSREDAQLESWSRCDHRSLCVWMDFCSVVSSN
KNLRVLDMTQSFLSDSSVRILCDHITRFSCHLQKVVIRNVTPDSAYRDFCLAFVGKKTLT
HLTLEGHVQWDDMLLLLLGEVLKHVKCSLQYLRLGFHSVTTERWTNLTLALKVNQSLMCL
DLSDNELLDESAKLLYTSLKGPKCLLQRL
Download sequence
Identical sequences H0Y0K8
ENSOGAP00000021901 ENSOGAP00000021901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]