SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021911 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021911
Domain Number 1 Region: 290-421
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.58e-44
Family Regulator of G-protein signaling, RGS 0.00000325
Further Details:      
 
Domain Number 2 Region: 12-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.12e-28
Family DEP domain 0.005
Further Details:      
 
Domain Number 3 Region: 217-278
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000000288
Family Transducin (heterotrimeric G protein), gamma chain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021911   Gene: ENSOGAG00000030392   Transcript: ENSOGAT00000026492
Sequence length 466
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:6397040:6408692:-1 gene:ENSOGAG00000030392 transcript:ENSOGAT00000026492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASPAPLGGRPRTQMSHLSKMERVVVSMQDPDQGVKMRSQRLLITVVPHAVMGGDVVEW
LIHKFCISEQEALHLGTLLVQHGYIYPLRDPRNLVLRPDETSYRFQTPYFWTSVLWPASE
LDYAIYLTKKNIRKQGALVDHEKEHYHQLHKKINHVWDLVVMQAREQLRAAKQRRKGDRL
VIACQEQTFWLVNRPPPGAPNVLEQGPQRGSCTTSCMQTAKNLDFYKLEIERCRKALGRT
RVKSSVCLEVYLKFSAQHRLHDPILSGCLPSNPWITDDAAYWAMNAPTVAAPTRLRMERW
AFSFRELLEDPVGRAHFMHFLRKEFSAENLSFWEACEEVRHGEQAQIPLLVDTVYQQFLA
PGAARWVNIDSRTMEQTLEGLHQPHRHVLDDAQLHIYMLMKKDSYPRFLKSDMYKGLLEE
AEIPLETKRRVFPFTWQPRHSSPSPALLPTSGEPMVVGSPRGDGEV
Download sequence
Identical sequences H0Y0L8
ENSOGAP00000021911 XP_003790926.1.62490 ENSOGAP00000021911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]