SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021965 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021965
Domain Number 1 Region: 60-123
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.01e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021965   Gene: ENSOGAG00000027928   Transcript: ENSOGAT00000032814
Sequence length 182
Comment pep:known_by_projection scaffold:OtoGar3:GL873580.1:9411180:9413078:1 gene:ENSOGAG00000027928 transcript:ENSOGAT00000032814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDPSHYGGVPPGAGPPGLGGPRP
VKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAK
DDQNGEAEAFKAEIKKTDVKEEKRKKELEDNEILKSTVSSSDKKTKGRTGWPQHVWALEL
KQ
Download sequence
Identical sequences H0Y0S2
ENSOGAP00000021965 ENSOGAP00000021965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]