SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021966 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021966
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000863
Family Hairy Orange domain 0.00013
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000981
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021966   Gene: ENSOGAG00000027812   Transcript: ENSOGAT00000031847
Sequence length 337
Comment pep:known_by_projection scaffold:OtoGar3:GL873521.1:20614702:20624612:1 gene:ENSOGAG00000027812 transcript:ENSOGAT00000031847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSADPLRVRLVSHLSTCASQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQPSGLHTSESTPCRLSTTSEVPPAHGSALLTATFAHADSALRM
PATGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQPSSGTNSKPYRPWGTEVGAF
Download sequence
Identical sequences H0Y0S3
ENSOGAP00000021966 ENSOGAP00000021966 XP_003781692.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]