SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022028 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022028
Domain Number 1 Region: 584-647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000011
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 505-551
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000128
Family TSP-1 type 1 repeat 0.00066
Further Details:      
 
Domain Number 3 Region: 639-695
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000848
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 2-49
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000106
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 55-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000632
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000022028
Domain Number - Region: 457-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 201-271
Classification Level Classification E-value
Superfamily BH3703-like 0.0484
Family BH3703-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022028   Gene: ENSOGAG00000015859   Transcript: ENSOGAT00000025551
Sequence length 868
Comment pep:known_by_projection scaffold:OtoGar3:GL873582.1:8364546:8410884:1 gene:ENSOGAG00000015859 transcript:ENSOGAT00000025551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVNCQWDSYAPWSECNGCTKTQTRRRSVSVYGQYGGRPCPGSAFETQSCEPTRGCPAEEG
CGERFRCFSGQCISRSLVCNGDSDCEEDSADEDRCEDSERKPVCDVEKPPPNIELTGNGY
NALTDQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNALSYTFQVLKLEDPLEDDRLKK
VVVITSMGHGENEEGKFSLGACPNSWSYVKHTSTEHTSSAKRRFLFSSSSSSSHSYTSNT
NEIHKKKMQMLEFFLELKEEFLQLAEPFWKELSHLPSLYDYGAYRRLIDQYGTHYLQSGS
LGGEYRVLFYLDSEKIQQSGMVLKKNCYLKHCVEITLASFLLWPKLTEVEENKCDSSNFH
FVFTSSKHKCKELEKALKSASGMRGGGAGFISGLSFLELDNPAGNKGRYSAWAESVTNLP
QVIKQKLTPLYELVKEVPCASVKRLYLKRALEEYLDEFDPCHCRPCQNGGMAIVVGTQCQ
CHCKPYTFGMACEKGVLVGDQAGGVDGGWSCWSSWGPCVQGKKTRSRECNNPPPSGGGKS
CLGETTEYGLCTDQELEHLRMGGVTGSSPVEWTQVATLASSKFCPSPPVLKDGFVQDEGT
MFPVGKNIKYTCNEGYSLIGDPVARCGEDLQWLVGEMHCQKIACVLPVLMDGIQSHPRKP
FYSVGEKVTFSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQKDAPLTQAVPGCQRWEK
LQNSRCVCKMPYECGNVHRYDLIIKKESTQHFSTNACEKRNMLYGNICKMHVLHCQGRNY
TLAGRDSCALPASAEKACDACPLWGKCDAQSSKCVCREASECEEEGFSVCVEVNGQEQTM
SECEAGVLRCRGQSFSLTNTRPCSVDTQ
Download sequence
Identical sequences H0Y0Y5
ENSOGAP00000022028 ENSOGAP00000022028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]