SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022247 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022247
Domain Number 1 Region: 92-280
Classification Level Classification E-value
Superfamily TRAF domain-like 7.19e-49
Family SIAH, seven in absentia homolog 0.000000297
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000022247
Domain Number - Region: 37-79
Classification Level Classification E-value
Superfamily RING/U-box 0.000151
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022247   Gene: ENSOGAG00000025744   Transcript: ENSOGAT00000027840
Sequence length 283
Comment pep:novel scaffold:OtoGar3:GL873636.1:1195749:1196622:-1 gene:ENSOGAG00000025744 transcript:ENSOGAT00000027840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRPTEMSHQPDLAQPAGPSQGPPPQGETPSSSYLRSIFECPACSAHVLPPIFQCRGGHLV
CISCRQKLTSCPTCRGPLGSFHNLALDRVAYSLSFPCKYTSAGCGTILPPAEKADHEEVC
DFRPYPCPCPGVRCPWAGFLDAVMPHLMYQHGNRIITLQGETATYFAMNINGVHCPFEWV
MIQSCFGLHFMVVLQKQENDDGEQRFCAMVRLLGTPQQAKNFTYQLELIGDRQRLTWEAP
PRSIRERIETAMMSSDCLIFDNKTAQLFADNGELTITVTIAEY
Download sequence
Identical sequences H0Y1K4
ENSOGAP00000022247 ENSOGAP00000022247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]