SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022269 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022269
Domain Number 1 Region: 70-127
Classification Level Classification E-value
Superfamily Kringle-like 5.42e-19
Family Fibronectin type II module 0.0027
Further Details:      
 
Domain Number 2 Region: 39-81
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000428
Family Fibronectin type II module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022269   Gene: ENSOGAG00000031710   Transcript: ENSOGAT00000032478
Sequence length 130
Comment pep:known_by_projection scaffold:OtoGar3:GL873836.1:364307:369273:1 gene:ENSOGAG00000031710 transcript:ENSOGAT00000032478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEGMRNLVRWLSLAVCIYRLNADLISHLHPPFQVISTHPCVFPFTYGDVTYYSCISVHSD
FDWCSFDKEFRGRWRYCTMSDPPRCVFPFLFRQKLYNECTKDGYILDRSWCSLTGDYNKD
GKWKQCSPNK
Download sequence
Identical sequences H0Y1M6
ENSOGAP00000022269 ENSOGAP00000022269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]