SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022271 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022271
Domain Number 1 Region: 161-220
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022271   Gene: ENSOGAG00000024685   Transcript: ENSOGAT00000029131
Sequence length 326
Comment pep:known_by_projection scaffold:OtoGar3:GL873538.1:11324887:11326504:-1 gene:ENSOGAG00000024685 transcript:ENSOGAT00000029131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVLLEHFPGGLDAFPSPYFDEEDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEY
CYRDGACLLLQPAPSTAPIALAPPPSGGPGEPEDGAGYCCEAGAPPGGFPCSPSSPPSCL
AYPCAGVGVLSPGARLRGLSGAAAVAARRRRRVRSEAELQQLRQAANVRERRRMQSINDA
FEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRL
GGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLTGHSLSWTDEKQLKEQNIIRTAKVWT
PEDPRKLNSKSSFNNIENEPPFEFVS
Download sequence
Identical sequences H0Y1M8
ENSOGAP00000022271 ENSOGAP00000022271 XP_003786803.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]