SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022282 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022282
Domain Number 1 Region: 147-208
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.45e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022282   Gene: ENSOGAG00000033339   Transcript: ENSOGAT00000027646
Sequence length 276
Comment pep:known_by_projection scaffold:OtoGar3:GL873646.1:1456435:1458155:1 gene:ENSOGAG00000033339 transcript:ENSOGAT00000027646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPPQAQTEVGPTMTEKAEMLCAPSLVPTLPPKPASPQAEEVGHQSSSPPRLPPGVPVIS
LGHTRPPGTAIPTTELSTLRPPLLQLSALGPTPPALALHYHPHPFLNSVYIGPAGPFSIF
PSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDR
KLSKNEVLRLAMKYIGFLVRLLRDQAAAVTAGPTPSGSRKRPAHRVPDDGVRQGSGRKAE
VTLSSQPGLPADPDGSPGGAAWPIKMEQTAMSPEVR
Download sequence
Identical sequences H0Y1N9
ENSOGAP00000022282 ENSOGAP00000022282 XP_012665626.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]