SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022322 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022322
Domain Number 1 Region: 76-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.28e-46
Family Regulator of G-protein signaling, RGS 0.000000398
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000022322
Domain Number - Region: 13-58
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0523
Family Troponin I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022322   Gene: ENSOGAG00000029311   Transcript: ENSOGAT00000033153
Sequence length 235
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:2823185:2845725:-1 gene:ENSOGAG00000029311 transcript:ENSOGAT00000033153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSLVFLSQLNMCESREKTFFKLIHSSGKEEASKEAKIRAKEKRNRLSLLVQKLEFHEE
THSGRSGKFAKETRVSPEEAVRWGESFDNLLSHRDGLEAFTRFLKTEFSEENIEFWKACE
DFKKSKEPQQIILKAKAIYEKFIENDAPQEVNLDFHTKEIIAKSITQPTLHSFDAAQSRV
YQLMEQDSYTRFLKSDIYLDLIEGRPQRPTNLRRRSRSFTCNEFQDVNSDVAIWL
Download sequence
Identical sequences H0Y1S9
ENSOGAP00000022322 ENSOGAP00000022322 XP_003785658.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]