SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022359 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022359
Domain Number 1 Region: 19-99
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000042
Family Snake venom toxins 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022359   Gene: ENSOGAG00000031312   Transcript: ENSOGAT00000026245
Sequence length 125
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:2597513:2601009:-1 gene:ENSOGAG00000031312 transcript:ENSOGAT00000026245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGLLLFTLSALLCWVSADIRCHSCYKVPVLGCVDRQSCRLEQGQQCLTTHVYLGKMWVF
SNLRCGTPEHPCQEAYNQTNNKLGLTYNTTCCNKDNCNSPAPRPTPALALIFFTSLAGLG
LWLMH
Download sequence
Identical sequences H0Y1W6
ENSOGAP00000022359 ENSOGAP00000022359 XP_003789074.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]