SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022362 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022362
Domain Number 1 Region: 99-149
Classification Level Classification E-value
Superfamily Orange domain-like 2.22e-16
Family Hairy Orange domain 0.0022
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022362   Gene: ENSOGAG00000032425   Transcript: ENSOGAT00000033138
Sequence length 280
Comment pep:known_by_projection scaffold:OtoGar3:GL873579.1:3032743:3035201:-1 gene:ENSOGAG00000032425 transcript:ENSOGAT00000033138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Download sequence
Identical sequences A0A096MST7 A0A0D9R942 A0A2J8WIA2 A0A2K5MC31 A0A2K5SF78 A0A2K5V1Z9 A0A2K6CU85 A0A2K6RS24 A0A2K6TV14 G3QZL7 H0Y1W9 H2QNZ9 I2CUI4 Q14469 U3BRX3
gi|5031763|ref|NP_005515.1| ENSPTRP00000027099 ENSP00000232424 ENSPTRP00000027099 ENSOGAP00000022362 9598.ENSPTRP00000027099 9606.ENSP00000232424 ENSOGAP00000022362 ENSP00000232424 ENSP00000232424 NP_005515.1.87134 NP_005515.1.92137 XP_003792741.1.62490 XP_003927082.1.74449 XP_004038278.1.27298 XP_005545422.1.63531 XP_008007747.1.81039 XP_010371302.1.97406 XP_011721388.1.29376 XP_011892181.1.92194 XP_014988012.1.72884 XP_017382141.1.71028 XP_516956.1.37143 ENSGGOP00000008330 ENSGGOP00000008330 ENSPANP00000002860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]