SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022382 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022382
Domain Number 1 Region: 115-176,204-303
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000017
Family 28-residue LRR 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022382   Gene: ENSOGAG00000028294   Transcript: ENSOGAT00000028960
Sequence length 371
Comment pep:novel scaffold:OtoGar3:GL873558.1:11361448:11364542:1 gene:ENSOGAG00000028294 transcript:ENSOGAT00000028960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHQGAPRLKGLAVQSLVRNETLAISALEEQHGLVFPPLFIEAFTERRSRVLTGRVQAWP
FTCLPLGFLKKTCDLETTLDESLTYLSVWAKHRKESIHLCCRTLDIEVSFQNIRKFLQSV
DLDCIQELEVSCHWKLPTLGQFSFYLARMSHLERLLVSYFRTPAYLSPMMGNKLDLHSDS
FLEGHLDQVLDQVPQDPTGDPLISCCRLVESDVSHLPWCLTLTQLKHLVLTKVKLTDFSP
EPLQFLLERVAATLQTLDLDDYGISDAQLRVILPSLSHCSQLTTFSFCRNQIFMPALEDL
IHHTAGLSKFNRGQYPVPLESYHASGTFYREILAQFAAKLRRTLRDSQTKKIFFGPVPCT
ECGNRFLYDLD
Download sequence
Identical sequences H0Y1Y9
ENSOGAP00000022382 ENSOGAP00000022382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]