SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022588 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022588
Domain Number 1 Region: 72-167
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.9e-38
Family Forkhead DNA-binding domain 0.0000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022588   Gene: ENSOGAG00000028090   Transcript: ENSOGAT00000028432
Sequence length 337
Comment pep:novel scaffold:OtoGar3:GL873591.1:7483448:7484749:-1 gene:ENSOGAG00000028090 transcript:ENSOGAT00000028432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKGCSRPSRETSPARPRPRRTCPRPPTWPSSFASVQQPFAQSWAVAPASPAAPAVQGELG
WSAAGDEDLLTVRPPYSYSALIAMAIQNAPGGKLTLRHIYQFVTDSFPFYQHSSARWQNS
IRHNLSLNDCFKKVPRDEDDPGKGHYWTLDPNCDKMFDNGNFRRKRRRRFEASSSSTLAA
GPLEAQGLSSVIGSAVGGKPEADSTSSLLMPSQSPQPPEGTQNPAWSPGGSMLTSTICLN
TFFNTLSSFSASRSGNTDQPALSGSGHLGIQGAQLPSSDTFPPEPISETSPDALQLSNSS
SPFPDSTSGDQNSPFGSPFYNFSSINSLIYPQEDSEV
Download sequence
Identical sequences H0Y2J5
ENSOGAP00000022588 ENSOGAP00000022588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]