SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000096 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000096
Domain Number 1 Region: 597-840
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.12e-81
Family Eukaryotic proteases 0.0000464
Further Details:      
 
Domain Number 2 Region: 100-232
Classification Level Classification E-value
Superfamily SEA domain 1.22e-22
Family SEA domain 0.0069
Further Details:      
 
Domain Number 3 Region: 247-360
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000301
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 4 Region: 376-476
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000615
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 5 Region: 482-519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 559-598
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 518-554
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000694
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000096   Gene: ENSOGAG00000000110   Transcript: ENSOGAT00000000110
Sequence length 844
Comment pep:known_by_projection scaffold:OtoGar3:GL873641.1:1604120:1639773:1 gene:ENSOGAG00000000110 transcript:ENSOGAT00000000110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKENSDTSSRPPELKISNISVQVVSAQGKLPGRRPPLPGRRPPLPGRPPRKPIGKPKPK
PKKQSKKKAPFWNVQNKIILFTVFLFVLAVIAWTLLWLYIIKTESKDAFYFAGMFRITNI
EFLPEYRQKESREFLSVARTVQQVVNLVYTTSAFSKFYKQSVVADVSSNNKGGLLVHFWI
VFVMPHAKGHIFCEDCVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNAGLRSDYSS
TIGSDKGCSQYVYADHLTFRYPLEISATSGRLMCHFKLVAIVGYLIRLSIESIQIEADNC
VTDSLTIYDSLLPIRSSILYRICEPTRTLMSFVSTNNLMLVTLKSPRIQKLSGIRAYFEV
IPEQKCENTVLVKETTGFEGKISSPYYPSYYPPKCKCTWRFQTSLSSLGIALKFHNYSIT
KKSEKGCEHGWWEINEHMYCGSYMDHQTIFRVPSPLVHVQLQCSSRLSDKPLLVEYGSYN
ISQPCPVGSFRCSSGLCVPQAQRCDGVNDCFDESDELFCVSPKPACNASSFRQHGPLVCD
GFRDCENGQDEQNCTQSIPCSNRTFKCGNDVCFRKQNAKCDGTVDCPDRSDEEGCSCSRS
SSSLHRIVGGTDTLEGAWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPW
TAHLGMHVQGNAKFVSPVRRIVVHEYYNSQTFDYDIALLQLSVAWPEALKQLIQPICIPP
AGQKVHSGEKCWVTGWGRRHEADNKGSPVLQQAEVELIDQTLCVSTYGIITSRMLCAGVI
SGKRDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVPWIHKYV
PSLL
Download sequence
Identical sequences H0WFR7
ENSOGAP00000000096 ENSOGAP00000000096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]