SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001153 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001153
Domain Number 1 Region: 260-399,479-698
Classification Level Classification E-value
Superfamily RNI-like 6.28e-47
Family 28-residue LRR 0.00014
Further Details:      
 
Domain Number 2 Region: 21-108
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000011
Family Nucleotide and nucleoside kinases 0.048
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000001153
Domain Number - Region: 206-285
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0589
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001153   Gene: ENSOGAG00000001290   Transcript: ENSOGAT00000001292
Sequence length 717
Comment pep:novel scaffold:OtoGar3:GL873783.1:1004046:1020464:1 gene:ENSOGAG00000001290 transcript:ENSOGAT00000001292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRSQKFIPFLQPRIAPQPIAHTVVLYGPAGVGKSTLAKQVFLDWAENNLNQMFNYVFYLR
CKELNHVGACSFAELIFKDWPEWLGCAAEVFGQAQKILFIIDGFEELRVPAGALIHDICG
NWEREDLGKLEMEEEDLCPFLDKGVLQRGCDGCYSLIHLSVQQFLAAMYYILDSEEQEEV
ECHRWDIREVQKLFSKEERVRNPSLTQVGYFLFGLSNEKRVQELESTFGCRMSLQIREEL
LKYRANLDENKPFSRTDMKELLYCLYESQDEGLMRDAMVPFTEVSLHWMNTFEVMYSSFC
LKHCQNLQKLSLQIARGIFLENDPVSREDAQLESWSRCDHRSLCVWMDFCSVVSSNKNLK
VLDMTQSFLSDSSVRILCDHITRFSCHLQKVVKFYQEIKTSRKWRHMLGIPGRETGKYVS
TFSNSNDELMTSVTGMALRNESGQGRVKQMQTQMWTGSILLVMFSLDFTCHVMSDKENSE
QCLYLFNTVTGRHRRGLIETRKLENCHLTEACCKQLASVLVVSQQLTYLSLAKNDLGDGG
VKFLCEGLGYPECKLQTLVLVLRQCNISRLGCKHLSKLFQGHSSLTSLDLGLNCITTGLW
FLCKALKNPFCNLKYLGLWGCSLTPFSCQDLSSALLSNQKLESLDLGQNNLGQSGVTLLF
EALKQKNGPLKTLRLKAYESNLKIQVLLEYIKENNPQLTIDCDAARTTRSSSCYYLS
Download sequence
Identical sequences H0WIA8
ENSOGAP00000001153 ENSOGAP00000001153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]