SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001373 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001373
Domain Number 1 Region: 754-981
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.3e-57
Family DBL homology domain (DH-domain) 0.00000000106
Further Details:      
 
Domain Number 2 Region: 350-525
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.88e-56
Family Regulator of G-protein signaling, RGS 0.0000000309
Further Details:      
 
Domain Number 3 Region: 986-1119
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-43
Family Pleckstrin-homology domain (PH domain) 0.000000279
Further Details:      
 
Domain Number 4 Region: 27-121
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-21
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000001373
Domain Number - Region: 149-159
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00262
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001373   Gene: ENSOGAG00000001540   Transcript: ENSOGAT00000001544
Sequence length 1561
Comment pep:known_by_projection scaffold:OtoGar3:GL873610.1:3290301:3345777:1 gene:ENSOGAG00000001540 transcript:ENSOGAT00000001544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLVCFLSSSCRLSSLSSLGDSAPERRSPSHHRQPSDTLETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSIGISGLQQDPSPAGAPQVTPVVPPPPPPPPLPPPQRITGPRPLQDPEVQKHATQ
ILRNMLRQEEKDLQRICEEYSRNPASLLEEQIEGARRRVSQLQLKIQQETGGLVDILPLY
SDTSLRPSEGRLSLDSQEGDSGLESGTERFPSLSESLVNRNSVLSDPGLDSPRTSPVITA
KVAQHHRRQGLDAPAPPAGDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLLFYLCVEVYQQTNSKESRSLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDSRLRSSEDARGVLYEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLD
GDLLRERQVAEKQLAALGDILSKYEEDRSAPMGFALNTYMSHAGIHLRDSRPSNTADKTQ
AAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEV
KPGNVRNIIQHFENNQQYEAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREE
MKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSI
ESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEVIN
ELFVTESSHLRTLRVLDLIFYQRMRKENLMPREELSRLFPNLPELIEIHNSWCEAMKRLR
EEGPIIREISDLMLARFDGPAREELQQVAAQFCSYQSVALELIKTRQRKESRFQLFMQEA
ESHPQCRRLQLRDLIVSEMQRLTKYPLLLENIIRHTEGGTSEHEKLCRARDQCREILKYV
NEAVKQTENRHRLEGYQKRLDTTALERASNPLAAEFKSLDLTARKMIHEGPLTWRISKDK
TLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDK
RAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAALTPVHALPPGRQ
EPAHQGPTASRAGLDDSEVFHSEPETKELPTGPGPQQRLPGKHPTLLEDPEQEGSEEEEE
ELGGLPHPSTSLDEENRGALTRVPIHLALPGPLSMEGLADSALEDVENLRHLVLWSLLPG
HTVDTQAAGEPEDDLTPTPSIMSTTSHPWDPGSPGRATTEGEQDTTQPPGPVRGAELEDM
ALSSLGNLPPRTRNSGIWESPELDRNPTEEASSTEAAGSYKVVRKAEVAGSKVVPALPES
GQSEPEPPEVESGAKATGNCFYVSMPAGPLDSSTDPSGAPMSPSQSDSLPAWQTEPRPQL
PGGSGGQRHPSSSTGSRSLETSVLAWESEGLSRPSLQLLQDMELAHKELLKTLGGESSGG
TTPVGSVHAEMARWTDSSLSPPKEPLASDSRNSHELGAYPDDGSDTPLEDGTVDTATSPG
P
Download sequence
Identical sequences H0WIU1
ENSOGAP00000001373 ENSOGAP00000001373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]