SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001728 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001728
Domain Number 1 Region: 418-574
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-26
Family SPRY domain 0.0075
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily RING/U-box 4.2e-16
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 3 Region: 168-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000198
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001728   Gene: ENSOGAG00000001935   Transcript: ENSOGAT00000001938
Sequence length 636
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:6043845:6047870:1 gene:ENSOGAG00000001935 transcript:ENSOGAT00000001938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSGPFSCPICREPLREPVTLPCGHNFCLACLGVLWPHRGSGGAGGPGGAARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSGPGPGPGPAPAPEPSAPSAPPSTPEPSAPCAPEPWPA
GEEPVPCDACPEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLEESLC
PRHLRPLERYCRAERVCLCEACAAQEHRGHELVPLEQERALQEAEQPKVLSAVEDRMDEL
GAGIAQARRTVALIKSAAVAERERVSRLFAEAAITLQGFQNQVLGFIEEGEAAMLGRSQG
DLRRQEEQRSRLTRARHNLNQVPEADSVSFLQELLALRLALEEGCGPGPGPPRELSFTKS
SQAVRAVRDVLAEVCASQWEQLQGLGSDEDGPQKLGSEADAESQDPDSTNQLESEAPRDY
FLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVLGEGALDRGTY
YWEVEIIEGWVSVGVMAEGFNPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPQ
PFSPTVGICLEYADRALAFYAVRDGKMSLLRRLKASRPRRSGIPASPVDPFQSRLDSHFA
GLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences H0WJP2
ENSOGAP00000001728 ENSOGAP00000001728 XP_003786170.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]