SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001814 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001814
Domain Number 1 Region: 207-287
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000124
Family DEATH domain, DD 0.027
Further Details:      
 
Domain Number 2 Region: 36-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000365
Family TNF receptor-like 0.0065
Further Details:      
 
Domain Number 3 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000198
Family TNF receptor-like 0.0025
Further Details:      
 
Domain Number 4 Region: 294-371
Classification Level Classification E-value
Superfamily DEATH domain 0.00000349
Family DEATH domain, DD 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001814   Gene: ENSOGAG00000002033   Transcript: ENSOGAT00000002034
Sequence length 401
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:10605078:10633219:1 gene:ENSOGAG00000002033 transcript:ENSOGAT00000002034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLLCCALVFLDISIKWTTQETFPPKYLHYDPETSRQLMCDKCPPGTYLKQHCTARWKT
VCAPCPNHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLELEFCLK
HRSCPPGFGVAQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVPGLLLTQKGNAT
HDNICSGNNESTPKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNPESIERI
KRRHSSQEQTFQLLKLWKHQNKDQDMVKKIIQDIDLCENSVQRHIGHANLSFEQLRSLME
SLPGKKVGLEDIAETRKACKSSDQVLKLLSLWRIKNGDQDTLKGLMHALKHSKAYHFPKT
VAQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences H0WJW5
XP_003782437.1.62490 ENSOGAP00000001814 ENSOGAP00000001814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]