SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002150 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002150
Domain Number 1 Region: 229-542
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.16e-68
Family N-type ATP pyrophosphatases 0.000000801
Further Details:      
 
Domain Number 2 Region: 1-194
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.8e-40
Family Class II glutamine amidotransferases 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002150   Gene: ENSOGAG00000002404   Transcript: ENSOGAT00000002408
Sequence length 564
Comment pep:known_by_projection scaffold:OtoGar3:GL873524.1:24942660:24957531:-1 gene:ENSOGAG00000002404 transcript:ENSOGAT00000002408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIWALFGCDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDQLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTVCMLDGV
FAFILLDTANKKIFLGRDTYGVRPLFKAITEDGFLAVCSEAKEFIGLVSLKHSMAPFLKV
EPFLPGHYEVLDLKPNGKVASVEMVKFHHCRDEPLHALYDNVEKLFPGFEIETVKSNLRI
LFNNAIKKRLMTDRRIGCLLSGGLDSSLVAATLVKQLKETQVQYTLQTFAIGMEDSPDLL
AARKVANHIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTD
SVVVFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELR
VPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSI
KNSWFKILQEYVEHQVDDTMMANAAQKFPFNTPKTKEGYYYRQIFERHYPGRANWLTHYW
MPKWITATDPSARTLMHYKSAAKA
Download sequence
Identical sequences H0WKN4
ENSOGAP00000002150 ENSOGAP00000002150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]