SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002937 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002937
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 4.15e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000497
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.41e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 431-491
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000262
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002937   Gene: ENSOGAG00000003288   Transcript: ENSOGAT00000003292
Sequence length 503
Comment pep:known_by_projection scaffold:OtoGar3:GL873672.1:2445282:2453848:1 gene:ENSOGAG00000003288 transcript:ENSOGAT00000003292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSGVTVGGRPGGRGGSAAQNIPSTLLQDHENQRVFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFQALVQEKIQKRNQRQSGDRRQLPPPPAPANEERRGGLPPLPPH
PGGDQGGPPAGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPIVGGNKGRSGPLPPVPLGGAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPPPPPPPGAGGPPLPPPPPPPPLPPPSTGDGPAPPPPPPTL
VPGGGLAPGGGRGALLDQIRQGIQLNKTSGSLESSTLQPPPQSSEGLVGALMHVMQKRSK
VIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences H0WMH0
ENSOGAP00000002937 ENSOGAP00000002937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]