SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003684 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003684
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-18
Family Clostridium neurotoxins, the second last domain 0.046
Further Details:      
 
Domain Number 2 Region: 222-347,412-479
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000269
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 357-520
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000203
Family Reprolysin-like 0.085
Further Details:      
 
Domain Number 4 Region: 1218-1290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000292
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 5 Region: 1157-1222
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000361
Family Complement control module/SCR domain 0.0046
Further Details:      
 
Domain Number 6 Region: 1285-1358
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000162
Family Complement control module/SCR domain 0.0058
Further Details:      
 
Domain Number 7 Region: 1087-1160
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000334
Family Complement control module/SCR domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003684   Gene: ENSOGAG00000004127   Transcript: ENSOGAT00000004131
Sequence length 1510
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:19310994:19530262:1 gene:ENSOGAG00000004127 transcript:ENSOGAT00000004131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLYDKCSYTSRDRGWVVGIHTVSDQGNRDPRYFFSLKTDRARQVTTINAHRSYLPGQWVY
LAATYDGKLMKLYVNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSAQNHNYRGYIEHFSL
WKVARSQPEILSDMEIHGLHPPLPQLLLQENWDNVKRTWSPMKDGSSPQVELSNAHGFLL
DTSLEPPLCGQTLCDNKEVITSYNQLPSFRRPKVVRYRVVNLYDDNHENPTVSRQQVDFQ
HRQLAEAFKHYNISWELEVLEVNNSSLRHRLILANCDISKIGDENCDPECNHTLTGHDGG
DCRHLRHPAFMKKQQNGICDMDCNYERFNFDGGECCDPDITDVTKTCFDPDSPHRAYLDV
NELKNILRLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGTPGHTH
TMIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKFCGDPGPG
NDTCGFHSFFNTPYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQNWQPSRKPAPVALA
PQVVGHTTDSVTLEWFPPIDGHFFERELGSACDLCLEGRILVQYAFNASSPMPCGPSGHW
SPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFLYPLIPESLTV
WVTFVSTDWDSSGAVNDIKLLTISGKNISLGPQNVFCDVPLTIRLRDVGEEVYGIQIYTL
DEHLEIDAAMLTSIADSPLCLECKPLQYKVVRNPPLQKAPSLLCLLENSSLYFSRNLNLG
SVYQYQIITISGTEESEPSPAAIYIHGSGYCGDGVIQKFCRGQGEECDDMNKINGDGCSL
FCQQEISFNCIEEPSRCYFHDGDGVCEEFERKTSIKDCGVYTPQGFLDQWASNVSVSHQD
QQCPGWVVIGQPAASQVCRTKVIDLSEGLSQHAWYPCTISYPYSQLAQTTFWLRSRGGLA
LSSQVFRIVPIALHLPPEGPLKTPQWLLNVGVALLGEGEELWALGVHVLSCRNNPLIIPV
VHDLSQPFYHSRAVRVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSPTEQSCVHF
TCEAADCPELAVENASLNCSSSDRYHGAQCTVNCQTGYVLQIQRDDELIKTQTGPSVTVT
CTEGKWNKQVVCEPVDCGVPDHHHVYAASFSCPKGTTFGRTCSFQCRHPAQLKGNNSQLT
CMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSR
KSKKRAFKTQCTQDGSWQEGACIPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEGVLWT
LSPLAACKHSRNGRGSNVIHCRKDGTWSGSFHVCQEMQGQCSAPNQLNSNLKLQCPDGYA
IGSECATSCLDHNSEPIILPVNVTVRDIPHWLNPARVERVVCTAGLKWYPHPALIHCVKG
CEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHS
RKDLRGYSHG
Download sequence
Identical sequences H0WP89
ENSOGAP00000003684 ENSOGAP00000003684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]