SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003961 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003961
Domain Number 1 Region: 329-403
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000451
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 127-202
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000129
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 964-1053
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000165
Family Carboxypeptidase regulatory domain 0.044
Further Details:      
 
Domain Number 4 Region: 883-954
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000981
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000003961
Domain Number - Region: 442-491
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00165
Family Carboxypeptidase regulatory domain 0.019
Further Details:      
 
Domain Number - Region: 810-868
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00294
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 215-299
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00667
Family Rhamnogalacturonase B, RhgB, middle domain 0.024
Further Details:      
 
Domain Number - Region: 51-112
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0392
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003961   Gene: ENSOGAG00000004434   Transcript: ENSOGAT00000004438
Sequence length 1222
Comment pep:novel scaffold:OtoGar3:GL873563.1:4790737:4852378:-1 gene:ENSOGAG00000004434 transcript:ENSOGAT00000004438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVSRGAGLPGSAAVAAAVVLLMIGVGPACGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELYVDGINDICTKGE
DINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
YEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSS
LVTKEDVLGCNVSPVPGFQPQDENLVYLCYVVSKEDGSFSFYSLPSGGYTVIPFYRGERI
TFDVAPSRLDFTVEHDSLKIEPMFHVMGFSVTGRVLNGPEGEGVPEAVVTLNNQIKVRTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISIIRFP
DTVKQMSKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLK
PQMFPLTVTDKPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKA
NSMTFTFDSVLPGKYKISIVHEDWCWKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAI
TLEFYQDGNGPENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILT
LTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIETRRQE
REKNGKEEGGEGRTKPPMQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSME
ATVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSV
GPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGG
VFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTA
YSCYGTVSSLNGEPEQGIAVEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKT
EGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYVLPQVSFTAVGYHKH
ITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQA
ASDNSGPEDAKRQAKKQKTRRT
Download sequence
Identical sequences H0WPW3
ENSOGAP00000003961 XP_003790764.1.62490 ENSOGAP00000003961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]