SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004067 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004067
Domain Number 1 Region: 347-618
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.56e-87
Family Eukaryotic proteases 0.00000000218
Further Details:      
 
Domain Number 2 Region: 106-194
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-32
Family Kringle modules 0.0000108
Further Details:      
 
Domain Number 3 Region: 212-298
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-27
Family Kringle modules 0.0000168
Further Details:      
 
Domain Number 4 Region: 47-108
Classification Level Classification E-value
Superfamily GLA-domain 2.35e-18
Family GLA-domain 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004067   Gene: ENSOGAG00000004555   Transcript: ENSOGAT00000004559
Sequence length 622
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:71872650:71893526:1 gene:ENSOGAG00000004555 transcript:ENSOGAT00000004559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHIRGLRLLGCLALAALCSLVHSQHVFLAPQQALSLLQRSRVRRANSGFLEEVRKGNLE
RECFEELCSYEEAFEALELSSTTDVFWAKYTACASVRKPREKFNECMEGNCAEGLGVNYR
GHVNFTHSGIECQLWRSHYPHKPEVNSTSHPGADLQENFCRNPDGSTTGPWCYTTDPTVR
REECSIPVCGQEHSTVKTTPRSRGSSLKESPTQEQCIPDRGKQYQGRLAVTTQGSPCLSW
ASTEAKALSKDQDFSPEVPLVENFCRNPDGDEEGAWCYVADKPGDFEYCDLNYCDVAMEE
EGDELDPETAIEGRTTTSEFQTFFNPKTFGAGEADCGLRPLFEKKSVKDKTEDELLESYI
EGRIVEGSDAEMGIAPWQVMLFQKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DILVRIGKHSRTRYERNIEKISMLEKVYIHPRYNWRENLDRDIALLKLKKPITFSDYIRP
VCLPDKEIVARLFRAGYKGRVTGWGNLREKWTPGTEEGQPKVLQVVNLPLVERQVCKAST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPYNDRWYQIGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDRFGG
Download sequence
Identical sequences H0WQ57
ENSOGAP00000004067 ENSOGAP00000004067 XP_003781330.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]