SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004186 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004186
Domain Number 1 Region: 16-274
Classification Level Classification E-value
Superfamily Caspase-like 9.57e-89
Family Caspase catalytic domain 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004186   Gene: ENSOGAG00000004685   Transcript: ENSOGAT00000004687
Sequence length 276
Comment pep:known_by_projection scaffold:OtoGar3:GL873648.1:402274:408327:-1 gene:ENSOGAG00000004685 transcript:ENSOGAT00000004687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETDAFYKSREMFDPAEEYKMDHKRRGIALIFNHERFFWHLTLPERRGTSADRDNLIRR
FSDLGFEVKCFNDLKAEELLRQIHEVSTSSHRDADCFLCVFLSHGEGNHIYAYDAKIEIQ
TLTGLFKGDKCQSLVGKPKIFIIQACRGDQHDVPVIPLDVVDHQTDKLNTNVTEVDAASV
YTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVS
QRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSK
Download sequence
Identical sequences H0WQF9
ENSOGAP00000004186 ENSOGAP00000004186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]